PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_09860
Common NameKK1_010142
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 303aa    MW: 33874.9 Da    PI: 8.3761
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_09860genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.8e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l ++++++G+g +W + ++++g++R++k+c++rw++yl
    C.cajan_09860 14 KGPWSPEEDAKLREYIEKHGTGgNWIALPQKVGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding36.51.2e-1169111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++  Ed+++  +++  G++ W+ Ia+ ++ gRt++++k++w++
    C.cajan_09860  69 GQFSDVEDKIICSLFASIGSR-WSIIASQLP-GRTDNDIKNYWNT 111
                      7899*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.382966IPR017930Myb domain
SuperFamilySSF466893.59E-2711109IPR009057Homeodomain-like
SMARTSM007178.0E-141364IPR001005SANT/Myb domain
PfamPF002498.6E-171462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-241569IPR009057Homeodomain-like
CDDcd001673.36E-101662No hitNo description
PROSITE profilePS5129414.86267117IPR017930Myb domain
SMARTSM007173.6E-1067115IPR001005SANT/Myb domain
PfamPF002492.0E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2270117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLREYIE KHGTGGNWIA LPQKVGLKRC GKSCRLRWLN  60
YLRPNIKHGQ FSDVEDKIIC SLFASIGSRW SIIASQLPGR TDNDIKNYWN TKLKKKMMAM  120
NASPQRKPQQ MTLLSILQSS TSSSTLSFRD SNNSYYHPQG SFSYSSSLLS GNNSSVSASA  180
DSFFQAQESL GVKCQFKDSI SNNSTFVCNN LSHAMEPEFG DATFVGANHL YSVAEDTTHK  240
LMFSNAASGS VSGWTDKQNG LWEQNPLDYG DLEEIKQLIG TNNSCNNNFL FDDKKTEERV  300
SYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-24141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ9028640.0DQ902864.1 Glycine max transcription factor MYBJ7 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006604580.11e-167PREDICTED: transcription factor RAX2
TrEMBLA0A151TV010.0A0A151TV01_CAJCA; Transcription factor RAX3
STRINGGLYMA19G36830.11e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.16e-76myb domain protein 36